PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2AS_4C9807337.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 239aa    MW: 26110.6 Da    PI: 9.8854
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2AS_4C9807337.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-161461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg W++e+de+l + v+q+G g+W++Ia+  g+ R++k+c++rw  yl
  Traes_2AS_4C9807337.1 14 RGLWSPEDDEKLMNHVAQYGYGCWSSIAKIAGLERCGKSCRLRWMHYL 61
                           788*****************************************9996 PP

2Myb_DNA-binding40.66e-1367109246
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            g++++ E++l+++++   G++ W+ Ia+ ++ gRt++++k++w++
  Traes_2AS_4C9807337.1  67 GPFSQGEEDLIIHLHSIRGNK-WSQIAAQLP-GRTDNEVKNFWNT 109
                            799******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.851965IPR017930Myb domain
SuperFamilySSF466891.55E-2911107IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-201264IPR009057Homeodomain-like
SMARTSM007171.7E-111363IPR001005SANT/Myb domain
PfamPF002491.9E-141461IPR001005SANT/Myb domain
CDDcd001676.52E-111761No hitNo description
SMARTSM007172.0E-1165113IPR001005SANT/Myb domain
PROSITE profilePS5129417.49566115IPR017930Myb domain
PfamPF002498.5E-1267109IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-1967112IPR009057Homeodomain-like
CDDcd001673.91E-868111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MSKRPGATKK RLKRGLWSPE DDEKLMNHVA QYGYGCWSSI AKIAGLERCG KSCRLRWMHY  60
LTPDRGGPFS QGEEDLIIHL HSIRGNKWSQ IAAQLPGRTD NEVKNFWNTI IKKKLRQRRI  120
DPAIHKPLAH AGAAAAATPV TRTAVFSEAE LILSSPVGTQ PMPPLVSAES YVYSRGSMDG  180
AGGAHAALGG CSDDGSLSSL SGYNNNQKAD FPGYLDADAL HGAVIPSVWS SRTLNWWRA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-24121155108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3537850.0AK353785.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1002L23.
GenBankAK3582100.0AK358210.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1071D01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958441.11e-91PREDICTED: myb-related protein Zm1-like
SwissprotQ8LPH61e-58MYB86_ARATH; Transcription factor MYB86
TrEMBLW5B1911e-179W5B191_WHEAT; Uncharacterized protein
STRINGSi029872m1e-89(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP6026522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.12e-59myb domain protein 86
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]